PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011071504.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family SBP
Protein Properties Length: 786aa    MW: 87802.6 Da    PI: 7.025
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011071504.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP115.33.3e-36134210177
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     +Cqv+gCe+d+se+k yh+rh+vC  +++a++v ++g+++r+CqqC++fh ls+fDe+krsCrr+L++hn+rrr+k 
  XP_011071504.1 134 RCQVPGCEVDISELKGYHKRHRVCLRCANASAVELDGESKRYCQQCGKFHILSDFDEGKRSCRRKLERHNNRRRRKP 210
                     6***********************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.1E-28129196IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.453132209IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-33133212IPR004333Transcription factor, SBP-box
PfamPF031103.9E-27135209IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 786 aa     Download sequence    Send to blast
MQQNPPQPPG IEPRVPGVPS AADRIPADDL TSSSLFNWSD FLDFNLDENL HISFPQTEPE  60
QPGIEESQPS ENSGLEKPGR VRKRDPRLVC SNFLAGRVPC ACPELDEKLE EEESALPGKK  120
RSRMLRASGG APARCQVPGC EVDISELKGY HKRHRVCLRC ANASAVELDG ESKRYCQQCG  180
KFHILSDFDE GKRSCRRKLE RHNNRRRRKP NDSKEGMQKE SQQAILVDDV SGDDDTGKDG  240
LCVSSQLEEK EMLLESDGHV STLCSALGSH SLQSDSVVSF PAFDEAHIVG DRQNPRYKHS  300
PSNCENKSTF SSVCPAGRIS FKLYDWNPAE FPRRLRHQIF QWLASMPIEL EGYIRPGCTI  360
LTAFIAMPKP VWLKLLAEPA LCIKDLVASP GSMLSGRGTM HVYLNDMMFR VSKDASSVVK  420
VKMKDRAPKL HYIYPTCFEA GRPMELVACG SYLLQPNFRF LISFAGRYLA YNICVSSCYE  480
KGDVNSSDHQ LLKIFVPQIN MDLFGPAFIE VENQSGLSNF IPILVGDKDT CAEMEMLQHK  540
FDAPVSSQER KSSPSPTACE AFASRQTLLS EFVLDVAWLL KKPVPEQQLT SSHIQRFNCL  600
LNFLIEKESS VVLERVFFSL KSAIDNNMVT GTSDSDMRLL QKNMDIAQHR LAHKLMVKDI  660
SVIPAGHGNF YSHSCQNDTV SVIPAANQVV QRMVKNMLGL NVPSPSLDES LTLPLLKQEV  720
IMDVNHQETL GKSSSRLLTR MFSTSRLLIM AIAAIGVCFG ICSIVLHPQR VDLIVTTIQR  780
CLFDNT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A9e-43130213184squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1195207RRKLERHNNRRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071504.10.0PREDICTED: squamosa promoter-binding-like protein 7
TrEMBLA0A022RZV00.0A0A022RZV0_ERYGU; Uncharacterized protein
STRINGVIT_05s0020g02160.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54072433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.10.0squamosa promoter binding protein-like 7